r2games.com

đź–Ą Status: up
đź•’ Response Time: 0.750 sec
⬅️ Response Code: 200
r2games.com

From January 28, 2021, through the past 2 024 days, the availability of r2games.com has been checked 43 times. As of June 28, 2026, r2games.com responded with a 200 status code and was accessible 43 times out of the total checks that were made. Throughout all evaluations done as of August 14, 2026, r2games.com did not experience any offline periods. As of August 14, 2026, no recorded response had an error status out of all the replies that were received. R2games.com's 0.750 seconds reply on June 28, 2026, contrasted its 0.943 seconds average response time.

4.0
43
Last Updated: June 28, 2026

R2games overview

Domain
r2games.com
Title
Play Free Online Games, MMORPG, Browser Games - R2Games
Description
R2Games delivers the best of free-to-play web games. Join our thriving community of online gaming enthusiasts! No downloads or installations required – play anytime, anywhere!
Keywords
R2Games, R2, Free Online Games, Online Gaming, Play Free Games, MMORPG, ARPG, SLG, Adventure Games, Action Games, Strategy Games, Causal, Multi-Language, Browser Games, Video Games, Titan Revenge, Game of Thrones Winter is Coming, Dark Odyssey, League of Angelsâ… , League of Angelsâ…ˇ, League of Angelsâ…˘, Crystal Saga...
E Site Status Rank
5 027
Search Wikipedia
r2games.com
Alternatives
alternatives to r2games.com
Recently checked
verycd.com

google.com.ua

Last Updated: July 4, 2026
Status: up
Response Time: 0.054 sec
Response Code: 200

appexus.review

Last Updated: June 6, 2026
Status: down
Response Time: — sec
Response Code: —

snapengage.com

Last Updated: May 31, 2026
Status: up
Response Time: 0.101 sec
Response Code: 200

onlinehdmovies.org

Last Updated: June 27, 2026
Status: up
Response Time: 0.325 sec
Response Code: 200

connectionivoirienne.net

Last Updated: May 4, 2026
Status: up
Response Time: 0.057 sec
Response Code: 200

smartystreets.com

Last Updated: June 21, 2026
Status: up
Response Time: 0.111 sec
Response Code: 200

housetrip.com

Last Updated: July 25, 2026
Status: up
Response Time: 0.516 sec
Response Code: 200

R2games.com
status check request map as of August 14, 2026

r2games.com request, June 28, 2026

Country report for r2games.com as of August 14, 2026

Other Countries 100.00%
22:06
SiteTotal ChecksLast Modified
desjardins.comdesjardins.com32January 29, 2021
verycd.comverycd.com44January 28, 2021
r2games.comr2games.com43January 28, 2021
fuskator.comfuskator.com155November 11, 2020
questionablecontent.netquestionablecontent.net51January 28, 2021

Smartystreets.com

R2games.com

General SEO Report

Page TitlePage Title tips for r2games.com: Incorporating the main topic or key benefit of the webpage directly into the title provides immediate value to the searcher, addressing their potential needs or questions and making it easier for search engines to categorize the page appropriately.
Play Free Online Games, MMORPG, Browser Games - R2Games

Length: 55 characters
Meta DescriptionMeta Description tips for r2games.com: The primary keyword must be strategically included within your meta description, woven in naturally and contextually, avoiding awkward stuffing to maintain readability and user interest, thereby improving its relevance in the eyes of search engines like Google and potentially enhancing local ranking for geographical keywords if applicable.
R2Games delivers the best of free-to-play web games. Join our thriving community of online gaming enthusiasts! No downloads or installations required – play anytime, anywhere!

Length: 181 characters
Meta KeywordsMeta Keywords tips for r2games.com: The era of meta keywords for SEO has passed; focusing on core web vitals, mobile-friendliness, and semantic HTML provides the foundation for better search engine visibility instead of keyword-tag manipulation.
R2Games, R2, Free Online Games, Online Gaming, Play Free Games, MMORPG, ARPG, SLG, Adventure Games, Action Games, Strategy Games, Causal, Multi-Language, Browser Games, Video Games, Titan Revenge, Game of Thrones Winter is Coming, Dark Odyssey, League of Angelsâ… , League of Angelsâ…ˇ, League of Angelsâ…˘, Crystal Saga...

Count: 47 words
Page ContentPage Content tips for r2games.com: Integrate long-tail keywords naturally throughout your page content, focusing on specific user questions and problems to capture niche traffic and improve semantic relevance.
Web Page Content Length: 20814 characters
H1 HeadingH1 Heading tips for r2games.com: Always ensure your H1 tag is concise, informative, and accurately represents the main theme or service offered on the page you are currently viewing and optimizing.
no h1 heading data for r2games.com
2026-08-14T09:21:55+00:00
H2 HeadingsH2 Headings tips for r2games.com: Formatting H2 headers consistently, using proper HTML tags and styling, creates a professional and user-friendly experience while also signaling clear content organization to search engine bots crawling the web document structure.
no h2 headings data for r2games.com
2026-08-14T09:21:55+00:00
H3 HeadingsH3 Headings tips for r2games.com: Employ H3 headers to visually guide users through your content, creating clear breaks between ideas while improving readability and encouraging longer session durations and reduced bounce rates.
Games
Desktop
Premium
HOT & NEW GAMES
FEATURED GAMES
Transferred-Platform Games


Count: 6 heading tag
H4 HeadingsH4 Headings tips for r2games.com: Incorporate H4 headers into a strategic content pillar framework, using them to define specific aspects and subsections of broader topics within your niche.
no h4 headings data for r2games.com
2026-08-14T09:21:55+00:00
H5-H6 HeadingsH5-H6 Headings tips for r2games.com: To maximize SEO benefits, reserve the H5-H6 heading structure strictly for granular subdivisions within consistently structured sections, like detailed steps within an instructional article or specific clauses within an FAQ block, rather than for general content segmentation.
no h5-h6 headings data for r2games.com
2026-08-14T09:21:55+00:00
Image ALT AttributesImage ALT Attributes tips for r2games.com: Regularly audit your website's ALT attributes to ensure they are descriptive, relevant, error-free, and consistently provide accurate descriptions for both search engines and visually impaired users seeking information.
https://r2cdn2.r2games.com/uploads/games/msapk_game_h.png
https://r2cdn2.r2games.com/uploads/games/loa_kong_game_h.png
https://r2cdn2.r2games.com/uploads/games/loa_armor_game_h.png


Count: 3 images with ALT attributes
Robots.txtRobots.txt tips for r2games.com: Block backend processing folders (e.g., `cgi-bin`, `/wp-admin`) using robots.txt to prevent search engines from wasting crawl budget on unimportant or non-public server-side resources.
file robots.txt was found on the website
XML SitemapXML Sitemap tips for r2games.com: Submitting your XML sitemap to Bing Webmaster Tools is crucial for maximizing your site's visibility and ensuring comprehensive indexing across all major search engines.
no xml sitemap data for r2games.com
2026-08-14T09:21:55+00:00
Page SizePage Size tips for r2games.com: Content-heavy websites benefit immensely from page size optimization techniques like efficient structuring and externalization of assets to ensure they remain performant and SEO-friendly despite large content libraries.
page size: 20 kb
Response TimeResponse Time tips for r2games.com: Optimize your application code, leverage browser caching, and fine-tune server configurations to achieve significantly lower response times, ensuring a seamless user experience and providing a competitive advantage in your industry.
response time: 0.943 sec
Minify CSSMinify CSS tips for r2games.com: Enhance website performance and SEO effectiveness by minifying CSS assets, stripping away non-essential characters and code elements, leading to smaller file sizes delivered quicker to visitors' browsers, which in turn helps achieve excellent Core Web Vitals results recognized by search engines like Google.
Unminified:
https://r2cdn2.r2games.com/en/www/css/pack/index.css?v=20240620
https://r2cdn2.r2games.com/en/www/css/pack/pre_reg.css
https://r2cdn2.r2games.com/en/www/css/common/media_jquery.css?v=20230828
https://r2cdn2.r2games.com/en/www/css/pack/search.css?v=20240621


included in the page
Minify JavaScriptMinify JavaScript tips for r2games.com: For e-commerce platforms or content-heavy sites, where page speed directly affects sales or user engagement, JavaScript minification is a cost-effective strategy to accelerate load times.
Minified:
https://r2cdn2.r2games.com/en/js/language/en.js
https://r2cdn2.r2games.com/en/js/search.js?v=20240906
https://r2cdn2.r2games.com/en/js/home.js?v=20220715
Unminified:
https://r2cdn2.r2games.com/en/js/lib/optiscroll.js?v=20240620
https://r2cdn2.r2games.com/en/js/lib/jquery.js


detected during site scan
Structured DataStructured Data tips for r2games.com: Schema markup doesn't guarantee top rankings but significantly improves the potential for rich search results, which often feature visually distinct, detailed information snippets that can substantially boost click-through rates (CTRs) from SERPs.
no structured data data for r2games.com
2026-08-14T09:21:55+00:00
CDN UsageCDN Usage tips for r2games.com: Set appropriate HTTP response headers on your CDN for assets like favicons and preloads to instruct browsers effectively, maximizing browser caching potential and ensuring these small elements load quickly without impacting the main page SEO.
content is delivered via CDN
SSL certificatesSSL certificates tips for r2games.com: Utilize HTTP Strict Transport Security (HSTS) headers on your secure pages to instruct browsers to always use HTTPS, preventing future HTTP access attempts, enhancing security automatically and positively signaling to search engines about your website's security commitment.
SSL is enabled on the website

Estimated Traffic

Minimum Daily Unique Visitors:419 403
Minimum Daily Visits:490 146
Minimum Daily Page Views:843 859
Minimum Monthly Unique Visitors:12 582 090
Minimum Monthly Visits:14 704 380
Minimum Monthly Page Views:25 315 770
Minimum Yearly Unique Visitors:150 985 080
Minimum Yearly Visits:176 452 560
Minimum Yearly Page Views:303 789 240
Maximum Daily Unique Visitors:530 570
Maximum Daily Visits:565 942
Maximum Daily Page Views:955 026
Maximum Monthly Unique Visitors:15 917 100
Maximum Monthly Visits:16 978 260
Maximum Monthly Page Views:28 650 780
Maximum Yearly Unique Visitors:191 005 200
Maximum Yearly Visits:203 739 120
Maximum Yearly Page Views:343 809 360

Estimated Valuation

Daily Revenue:US$ 606 - 1 364
Monthly Revenue:US$ 18 180 - 40 920
Yearly Revenue:US$ 218 160 - 491 040

Estimated Worth

Minimum:US$ 327 240
Maximum:US$ 1 473 120

Similarly Ranked Sites

RankPoints
aircanada.comaircanada.com5 39913 042 660
plaync.complaync.com5 40013 042 660
nchsoftware.comnchsoftware.com5 40113 042 659
desjardins.comdesjardins.com5 40213 042 658
verycd.comverycd.com5 40313 042 657
r2games.comr2games.com5 40413 042 656
fuskator.comfuskator.com5 40513 042 655
questionablecontent.netquestionablecontent.net5 40613 042 654
thumbtack.comthumbtack.com5 40713 042 653
watchmygirlfriend.tvwatchmygirlfriend.tv5 40813 042 652
lever.colever.co5 40913 042 651